PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_010545666.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Cleomaceae; Tarenaya
Family MYB_related
Protein Properties Length: 350aa    MW: 37721.2 Da    PI: 9.7991
Description MYB_related family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_010545666.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding408.8e-13120164347
                      SS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
  Myb_DNA-binding   3 rWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 
                      +WT++E+ l++ + ++lG+g+W+ I++   + Rt+ q+ s+ qky
   XP_010545666.1 120 PWTEDEHRLFLVGLQKLGKGDWRGISKSYVTSRTPTQVASHAQKY 164
                      8*******************************************9 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:4.10.60.108.1E-4222IPR001878Zinc finger, CCHC-type
PROSITE profilePS5129418.215113169IPR017930Myb domain
SuperFamilySSF466898.58E-17115169IPR009057Homeodomain-like
TIGRFAMsTIGR015575.9E-18116168IPR006447Myb domain, plants
SMARTSM007176.4E-10117167IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.603.5E-10117163IPR009057Homeodomain-like
PfamPF002498.4E-11120164IPR001005SANT/Myb domain
CDDcd001677.16E-9120165No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009651Biological Processresponse to salt stress
GO:0009723Biological Processresponse to ethylene
GO:0009733Biological Processresponse to auxin
GO:0009739Biological Processresponse to gibberellin
GO:0009753Biological Processresponse to jasmonic acid
GO:0046686Biological Processresponse to cadmium ion
GO:0003677Molecular FunctionDNA binding
GO:0008270Molecular Functionzinc ion binding
Sequence ? help Back to Top
Protein Sequence    Length: 350 aa     Download sequence    Send to blast
MTRRCSHCSN NGHNSRTCPT RGGGGGSPVA AVKLFGVRLT DGSIIKKSAS MGNLSALAAA  60
AAAQHHHHLP SFPTASMNRD SPLSGQVRDA THRTDGYLSD DPAHGSGSSH RRGERKKGVP  120
WTEDEHRLFL VGLQKLGKGD WRGISKSYVT SRTPTQVASH AQKYFIRQSS SSRVKRRSSL  180
FDMVTDDMVI EALPGKEDRA FHLSPSLEPE NSISLPSLDL SLGTAEREPA STASQDRTKE  240
PKDEINPSNG LSPMLVPGIF PSCVPLNYKL WFPTASTSPL GQGYGLEATT QHQVLKPNPG  300
FSKERANVDQ LVGMLQLRIG EAEGNKREPS SAFHPNGSDL NQGNSAIQAL
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010545666.10.0PREDICTED: myb-like protein J
TrEMBLR0HYV31e-140R0HYV3_9BRAS; Uncharacterized protein
STRINGfgenesh2_kg.3__1788__AT3G16350.11e-137(Arabidopsis lyrata)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM93132735
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G16350.11e-132MYB_related family protein